Információ

Lehet-e erősen szabályozni egy konstitutívan aktív kinázt?

Lehet-e erősen szabályozni egy konstitutívan aktív kinázt?


We are searching data for your request:

Forums and discussions:
Manuals and reference books:
Data from registers:
Wait the end of the search in all databases.
Upon completion, a link will appear to access the found materials.

Tanulmányozom a GSK3 protein kinázt, és ismerkedem aktivitásának szabályozásával. Sok folyóirat, amelyet olvastam, kijelentette, hogy a GSK3 egyedülálló, mert egy konstitutívan aktív kináz, ami azt jelenti, hogy mindig aktív, és nem aktiválódik egy adott ingerre/állapotra válaszul. Azt olvastam, hogy a GSK3 foszforilációja bizonyos tirozinmaradékokon csak fokozza annak aktivitását, de maga a GSK3 mindig aktív.

Azonban ezek közül a cikkek közül sok a GSK3 aktivitásának szabályozásának különböző mechanizmusairól is szól (például foszforiláció specifikus aminosavaknál, szubcelluláris lokalizáció, fehérjekomplex képződés). Az egyik papír a következőket írja:

A GSK3 által szabályozott számos funkció (számos szubsztrát foszforilációja révén) arra utal, hogy a GSK3 aktivitását erősen szabályozni kell. Négy kulcsfontosságú mechanizmust azonosítottak, amelyek hozzájárulnak a GSK3 hatásainak szubsztrát-specifikus szabályozásához. Ezek közé tartozik magának a GSK3-nak a foszforilációja általi szabályozása, a GSK3 szubcelluláris lokalizációja, a GSK3-at tartalmazó fehérjekomplexek képződése és a GSK3 szubsztrátok foszforilációs állapota.

Kíváncsi vagyok, hogyan lehetséges, hogy egy kináz konstitutívan aktív és erősen szabályozott egyszerre? Ha konstitutívan aktív, ez nem azt jelenti, hogy mindig aktív? Minden meglátást nagyra értékelünk.


Azt hiszem, megválaszoltad a saját kérdésedet, de igen, a nómenklatúra zavaró. Amikor azt mondják, hogy ez egy konstitutívan aktív kináz, akkor igazad van, ez egyértelműen azt jelenti, hogy az enzim mindig képes más molekulákat/fehérjéket foszforilálni.

A szabályozási rész az Ön által idézett áttekintő dokumentumban található. Ha a kináz mindig be van kapcsolva, de egy olyan rekeszben található, ahol nincs mit foszforilálni, akkor „szabályozottnak” tekinthető. Ugyanez a logika érvényes a többi felsorolt ​​szabályozási módra is.


Egy mitogén által aktivált protein kináz/extracelluláris szignál-szabályozott kináz kináz (MEK) függő transzkripciós program szabályozza a korai növekedési válasz 1 (EGR1) gén aktiválását az aminosav korlátozás alatt

Az emlőssejtekben az aminosav (AA) korlátozása jelátviteli kaszkádok gyűjteményét váltja ki, amelyeket együttesen AA válasznak (AAR) neveznek. Humán HepG2 hepatocelluláris karcinómában a korai növekedési válasz 1 (EGR1) gént AA depriváció vagy endoplazmatikus retikulum stressz indukálta. Felfedezték, hogy az AAR-függő EGR1 aktiváció független a jól jellemezhető GCN2-ATF4 útvonaltól, hanem a MEK-ERK jelátviteltől, az egyik MAPK útvonaltól függ. A ChIP azt mutatta, hogy az EGR1 proximális promoter régiójában konstitutívan kötött ELK1 foszforilálódott az AAR aktiválása után. A megnövekedett p-ELK1 kötődés az RNS polimeráz II fokozott de novo toborzásával járt az EGR1 promoterhez. Az EGR1 transzkripció nem indukálódott az endogén MEK-aktivitást nélkülöző HEK293T sejtekben, de az exogén konstitutívan aktív MEK túlzott expressziója a HEK293T sejtekben megnövekedett bazális és AAR-indukált EGR1 expressziót eredményezett. A humán vaszkuláris endoteliális növekedési faktor A (VEGF-A) gén, egy ismert EGR1-re reagáló gén ChIP elemzése mérsékelt növekedést mutatott ki az AAR által kiváltott EGR1 kötődésben a proximális promoterben, és erősen indukálható kötődést az első intronban lévő helyre. Ezek az adatok együttesen egy új, AA-aktivált MEK-ERK-ELK1 jelzőmechanizmust dokumentálnak.

Kulcsszavak: ATF4 aminosav aminosav válasz Aszparagin szintetáz géntranszkripció HepG2 sejtek Hepatocelluláris karcinóma Mitogén által aktivált protein kináz (MAPK) transzkripció.

© 2014: The American Society for Biochemistry and Molecular Biology, Inc.


BEVEZETÉS

A szabályozott sejtvándorlás számos élettani folyamathoz szükséges, beleértve az immunsejtek működését, a szövetek átépülését, a neurogenezist és a sebgyógyulást. A sejtmigráció nem megfelelő szabályozása hozzájárulhat a kóros folyamatokhoz, beleértve a tumorsejtek invázióját és metasztázisát. A sejtvándorlás egy koordinált folyamat, amely magában foglalja a sejtmembrán irányított kitüremkedését, a membránnak a szubsztrátumhoz való rögzítését, a sejttest összehúzódását és a sejt hátsó részének leválását (Lauffenburger és Horwitz, 1996). Az aktin citoszkeleton dinamikus átszervezése a Rho GTPases Rac, Cdc42 és Rho által irányítja a sejtmozgást (Ridley, 2001 Etienne-Manneville és Hall, 2002). A Rac és a Cdc42 aktiválása elősegíti az aktin filamentumok polimerizációját és a membrán kitüremkedését az Arp 2/3 komplex aktiválásával ( Ma et al., 1998 Machesky et al., 1999 Rohatgi et al., 1999 Miki et al., 2000). A Rac elősegíti az átmeneti, kialakulóban lévő adhéziós helyek kialakulását a sejtmembrán-nyúlványok csúcsain, amelyeket fokális komplexeknek neveznek (Nobes és Hall, 1999 Rottner et al., 1999). A Rho elősegíti a sejtösszehúzódást, az aktin stresszrostok képződését és a fokális komplexek érését nagyobb, stabilabb tapadó struktúrákká, amelyek fokális adhézióként ismertek (Chrzanowska-Wodnicka és Burridge, 1996 Clark et al., 1998 Nobes és Hall, 1999 Rottner et al., 1999). Több mint 50 fehérjéről kimutatták, hogy lokalizálódik a fokális adhéziókban, beleértve az integrineket, az extracelluláris mátrix fehérjék transzmembrán receptorait, az src és FAK protein kinázokat, valamint a paxillin, α aktinin és vinculin adapterfehérjéket, amelyek összekötik az integrint és a fehérjét kinázok az aktin citoszkeletonhoz (Geiger et al., 2001 Zamir és Geiger, 2001). A fokális adhéziók nemcsak az extracelluláris mátrix, az integrinek és az aktin citoszkeleton közötti kapcsolatként szolgálnak, hanem a sejtnövekedési és sejthalál-válasz szabályozásában fontos jelátviteli központokként is funkcionálnak.

A közelmúltban kimutatták, hogy a p21-aktivált kináz (PAK)1 fokális komplexekben lokalizálódik a membrán kiemelkedések csúcsainál, válaszul olyan ingerekre, amelyek aktiválják a Rac-et és a Cdc42-t, és elősegítik a sejtmigrációt (Dharmawardhane et al., 1997 Eladja et al., 2000). A szerin/treonin kinázok PAK családja a Rac és a Cdc42 fontos effektorai (Bokoch, 2003). A PAK 1𠄳 aktiválódik az aktív Rac és Cdc42 PAK homodimerekhez való kötődésével egy N-terminális szabályozó doménben (Parrini) et al., 2002). A GTPáz kötődés megzavarja a PAK kináz domén és a PAK autoinhibitor domén közötti gátló kölcsönhatást, ami PAK foszforilációt és aktiválódást eredményez ( Zhao et al., 1998 Zenke et al., 1999). Kimutatták, hogy a PAK1 modulálja az aktin és a mikrotubulus citoszkeletonok dinamikáját a sejtmigráció szabályozása érdekében. A konstitutívan aktivált PAK1 mutánsok túlzott expressziója az aktin stresszrostok feloldódását és a fokális adhéziókat indukálja, valamint növeli a membrán kitüremkedését, a sejtpolarizációt és a sejtmozgást (Manser et al., 1997 Eladja et al., 1997, 1999 Frost et al., 1998). Ezzel szemben az endothel sejtekben az aktív PAK1 túlzott expressziója csökkent sejtmigrációt, valamint az aktin stresszrostok és a fokális adhéziók stabilizálását eredményezi (kiosses). et al., 1999). Ezeket a hatásokat a PAK citoszkeletális szabályozó fehérjékre, például a LIM kinázra (Edwards) gyakorolt ​​hatása közvetíti. et al., 1999), miozin könnyű lánc kináz (Sanders et al., 1999), filamin A (Vadlamudi et al., 2002), és Op18/Stathmin (Daub et al., 2001 Wittmann et al., 2003). A megnövekedett PAK aktivitás összefüggést mutatott az emberi emlőrák sejtvonalak fokozott motilitásával és invazivitásával (Vadlamudi et al., 2000 ).

A PAK1-et fokális adhéziókra és fokális komplexekre lokalizáló molekuláris mechanizmus(ok)at kezdik vizsgálni. A kináztól elhalt PAK1 vagy a PAK1 kináz domén csonkítási mutánsának ektopikus expressziója, de nem vad típusú vagy konstitutívan aktív PAK1, a PAK lokalizációját eredményezi a HeLa sejtekben lévő fokális adhéziókban (Manser et al., 1997). A vad típusú PAK1 fokális adhéziókra lokalizálódik mind a PAK autoinhibitor doménjének (Zhao) jelenlétében et al., 2000a) és a Rac vagy Cdc42 aktivált formáinak expressziója esetén (Manser et al., 1997). Megvizsgáltuk a PAK1 fokális adhéziós célzáshoz szükséges régióit. A PAK1 N-terminálisa több prolinban gazdag helyet tartalmaz, amelyek az src homology (SH)3 domént tartalmazó fehérjékhez kötődnek, beleértve az NCK adapterfehérjéket (Bokoch). et al., 1996 Galisteo et al., 1996) és Grb2 (Puto et al., 2003) és a PIX guanin nukleotidcsere faktor (Manser et al., 1998). Mind a PIX, mind az NCK szerepet játszik a PAK lokalizációjában a fokális adhéziókban, mivel az NCK- ( Zhao et al., 2000a) vagy PIX-kötés (Manser et al., 1998) a prolinban gazdag régiók megszüntették az ektopikusan expresszált PAK1 azon képességét, hogy fokális adhéziókhoz lokalizálódjanak. A közelmúltban kimutatták, hogy a nagyon homológ ARF GAP fehérjék PKL (Turner et al., 1999) és GIT1 (Premont et al., 1998) fontos szerepet játszanak a PAK-nak a fokális adhéziókra való célzásában (Brown et al., 2002 Manabe Ri et al., 2002). A PKL és a GIT1 adapter fehérjeként szolgálnak, képesek megkötni a fokális adhéziós fehérjét, a paxillint és a PAK-hoz kapcsolódó PIX-et (Turner et al., 1999 Zhao et al., 2000b). A PKL-hez már nem kötődő paxillin mutánsok túlzott expressziója megakadályozta a PAK N-terminálisának lokalizációját fokális adhéziókhoz ( Brown et al., 2002 ).

Ebben a tanulmányban kimutattuk, hogy a PAK1 és/vagy PAK2 konstitutívan aktiválódik az SK-BR-3 és ZR-75-1 humán emlőrák sejtvonalakban, magas szintű aktivált Rac1 vagy Cdc42 hiányában. Ezenkívül az endogén, aktivált PAK konstitutívan lokalizálódik a nagy, atipikus fokális adhéziós struktúrákban. A PIX-nek, de nem a Rho GTPázoknak vagy az NCK-nak a PAK-hoz való kötődése célozza a PAK-ot ezekhez a fokális adhéziókhoz. A PAK kiszorítása a fokális adhéziókból megszünteti a konstitutív PAK aktivitást, és ezeknek a paxillint és PIX-et tartalmazó adhéziós struktúráknak a megnövekedett forgalmához vezet. Ezek az eredmények a PAK/PIX asszociáció váratlan szerepére utalnak a paxillint tartalmazó fokális adhéziók fenntartásában.


Tartalom

A protein-kinázok olyan enzimcsoportok, amelyek egy katalitikus alegységet tartalmaznak, amely a gamma (terminális) foszfátot a nukleozid-trifoszfátokból (gyakran ATP-ből) a fehérjeszubsztrát oldalláncában lévő egy vagy több aminosavra viszi át, ami a fehérje működését befolyásoló konformációs változást eredményez. . Az enzimek két nagy csoportba sorolhatók, amelyeket a szubsztrát-specifitás alapján jellemeznek: szerin/treonin-specifikus és tirozin-specifikus (a cikk tárgya). [1]

A kináz enzimek nagy családja, amelyek felelősek egy foszforilcsoport nukleozid-trifoszfát donorból, például ATP-ből egy akceptormolekulába történő átvitelének katalizálásáért. [2] A tirozin-kinázok katalizálják a fehérjékben lévő tirozin-maradékok foszforilációját. [2] A tirozin maradékok foszforilációja viszont megváltoztatja a fehérje működését, amelyben ezeket tartalmazzák. [2]

A tirozinmaradékokon történő foszforiláció a fehérjék tulajdonságainak széles skáláját szabályozza, mint például az enzimaktivitás, a szubcelluláris lokalizáció és a molekulák közötti kölcsönhatás. [3] Ezenkívül a tirozin-kinázok számos jelátviteli kaszkádban működnek, ahol az extracelluláris jelek a sejtmembránon keresztül a citoplazmába és gyakran a sejtmagba jutnak, ahol a génexpresszió módosulhat. [3] Végül a mutációk egyes tirozin-kinázok konstitutívan aktívvá válását okozhatják, ami egy nonstop funkcionális állapot, amely hozzájárulhat a rák kialakulásához vagy progressziójához.

A tirozin kinázok számos folyamatban, útvonalon és cselekvésben működnek, és felelősek a szervezet kulcsfontosságú eseményeiért. A receptor tirozin kinázok a transzmembrán jelátvitelben működnek, míg a sejten belüli tirozin kinázok a sejtmagba történő jelátvitelben. [4] A tirozin-kináz aktivitása a sejtmagban magában foglalja a sejtciklus szabályozását és a transzkripciós faktorok tulajdonságait. [3] Ily módon valójában a tirozin kináz aktivitása vesz részt a mitogenezisben, vagy a sejtben a mitózis indukálásában A citoszolban lévő fehérjék és a sejtmagban lévő fehérjék foszforilálódnak a tirozin maradékokon e folyamat során. [3] A sejtek növekedése és szaporodása bizonyos mértékig a tirozin-kinázra támaszkodhat. A tirozin kináz működését figyelték meg a magmátrixban, amely nem a kromatint, hanem a nukleáris burkot és a DNS fizikai stabilizálására szolgáló „szálas hálót” tartalmazza. [3] Konkrétabban, a Lyn, az Src családba tartozó kinázok egyik típusa, amelyet a sejtmag mátrixában azonosítottak, úgy tűnik, hogy szabályozza a sejtciklust. Az Src család tirozin kinázai szorosan rokonok, de sokféle funkciót mutatnak. Az Src család tirozin kinázainak szerepe vagy expressziója jelentősen eltér a sejttípustól függően, valamint a sejtnövekedés és differenciálódás során. [3] A Lyn és Src család tirozin kinázairól általában ismert, hogy a jelátviteli útvonalakban működnek. [3] Bizonyíték van arra, hogy a Lyn a sejtmembránon lokalizálódik. A Lyn mind fizikailag, mind funkcionálisan kapcsolatban áll számos receptormolekulával. [3]

A poliomavírus által transzformált fibroblasztok – az extracelluláris mátrixot és kollagént szintetizáló, a sebgyógyulásban részt vevő sejttípusok – nagyobb tirozinaktivitást mutatnak a sejtmátrixban. Ezenkívül megállapították, hogy a tirozin-kináz aktivitás korrelál a sejttranszformációval. [3] Azt is kimutatták, hogy egy közepes T-antigén foszforilációja a tirozinon szintén összefügg a sejttranszformációval, ami a sejtnövekedéshez vagy -szaporodáshoz hasonló változás. [3]

A mechanikai erő és a szabályozó jelek átvitele alapvető fontosságú az élő szervezet normális túlélésében. Ebben a feladatban a protein tirozin kináz is szerepet játszik. A pp125 nevű protein tirozin kináz valószínűleg kéznél van a celluláris fokális adhéziók hatására, amint azt az említett kináz immunfluoreszcens lokalizációja jelzi. A fokális adhéziók olyan makromolekuláris struktúrák, amelyek a mechanikai erők és szabályozó jelek átvitelében működnek. [5] A tudományos közösségben a pp125-öt FAK-nak (focal adhesion kinase) is emlegetik, a sejtes fokális adhéziókban már említett jelenléte miatt. A pp125 protein tirozin kináz az egyik fő foszfotirozint tartalmazó fehérje a nem érintett (nem transzformált) madarak és rágcsálók fibroblaszt sejtjeiben (a fibroblaszt sejteket fentebb részletesen ismertetjük). [5] A fibroblasztok olyan sejttípusok, amelyek az állatok sebgyógyulásáért és sejtszerkezetéért felelősek, számos egyéb viszonylag kisebb, de fontos feladat mellett, amelyek gyakran vagy alkalmanként előfordulnak. A pp125 szekvenciája és szerkezete a National Biomedical Research Foundation és a GenBank adatbázisokkal összehasonlítva [5] egészen egyedi lehet, ami azt jelenti, hogy a protein tirozin kináz család új tagja lehet. Ez a protein-tirozin-kináz akár körülbelül 70%-ban egyedülálló néhány más protein-tirozin-kinázhoz képest, ami eltér a már kialakult protein-tirozin-kináz-család tényleges tagjaitól. [5] Ezenkívül a megfigyelt aminosav-szekvencia közvetve azt jelzi, hogy a citoplazmához kapcsolódik, és a citoplazmatikus protein-tirozin-kinázok nagy csoportjának egyikének nevezik. [5] Akkor fedezték fel, amikor a monoklonális antitestek felismerték. [5] A pp60v-src által transzformált csirkeembriósejtekből származó monoklonális antitestek hét különböző foszfotirozint tartalmazó fehérjét ismernek fel. [5] Az egyik ilyen monoklonális antitest, a 2A7, felismeri a pp125-öt, ami alátámasztja azt az elképzelést, hogy a pp125 valójában egy protein tirozin kináz. [5]

A sejtproliferáció, amint azt a fentiekben részletesen kifejtettük, részben tirozin-kinázon alapulhat. [3] A nukleáris mátrixban tirozin-kináz funkciót figyeltek meg. A Lyn, az a kináz típus, amelyet elsőként fedeztek fel a nukleáris mátrixban, a tirozin kinázok Src családjába tartozik, amely a differenciálódó, kalcium által kiváltott kertinociták magjában található. Lynt a magmátrixban, a nukleáris burok és a DNS-t fizikailag stabilizáló „szálas háló” között találták a mátrixszal kapcsolatban. Ezenkívül úgy tűnt, hogy ez a sejtciklushoz kötött. [3] A Lyn fehérje hozzájárulása a teljes tirozin kináz aktivitáshoz a nukleáris mátrixon belül nem ismert, azonban mivel a Lyn-t csak részben vonták ki, aktivitásának pontos mérése nem volt lehetséges. [3] A jelek, mint ilyenek, Vegesna szerint et al. (1996) szerint a Lyn-polipeptidek a nukleáris mátrix tirozin-kináz aktivitásához kapcsolódnak. A kivont Lyn enzimatikusan aktív volt, ami alátámasztotta ezt az elképzelést.

A protein tirozin kináz egy másik lehetséges és valószínű szerepe az endotoxin okozta keringési elégtelenség és szervi diszfunkció patkányoknál, ahol a tirfosztin és genistein inhibitorok hatása összefügg a protein tirozin kinázzal. [4] A sejtek membránjában lévő receptorok által fogadott, környezeti jelek a sejt citoplazmájába kerülnek. Transzmembrán jelátvitel receptor tirozin kinázok miatt, Bae szerint et al. (2009) nagymértékben támaszkodik a kölcsönhatásokra, például az SH2 fehérjedomén által közvetített kísérletekkel megállapították, hogy az SH2 fehérje doménszelektivitása funkcionálisan közvetíti a tirozin-kinázt érintő celluláris folyamatokat. A receptor tirozin kinázok ezzel a módszerrel befolyásolhatják a növekedési faktor receptor jelátvitelét. Ez az egyik legalapvetőbb sejtkommunikációs funkció, a metazoán. [6]

Néha jelentős változásokat idéznek elő, ha a tirozin-kináz enzimet más tényezők befolyásolják. Az egyik tényező egy molekula, amelyet reverzibilisen köt egy fehérje, az úgynevezett ligandum. Számos receptor tirozin-kináz, bár természetesen nem mindegyik, nem fejt ki protein-kináz aktivitást addig, amíg el nem foglalja vagy aktiválja őket valamelyik ligandum. [2] Bár több kutatás azt jelzi, hogy a receptorok továbbra is aktívak maradnak az endoszómákon belül, egykor úgy gondolták, hogy a ligandumok által okozott endocitózis volt az az esemény, amely felelős a receptorok inaktiválódásáért. Az aktivált receptor tirozin kináz receptorok rövid időn belül internalizálódnak (visszakerülnek a rendszerbe), és végül a lizoszómákba kerülnek, ahol az emésztésben részt vevő katabolsav hidrolázokkal szomszédossá válnak. Az internalizált jelátviteli komplexek különböző szerepet töltenek be a különböző receptor tirozin kináz rendszerekben, amelyek sajátosságait kutatták. [7] Ezenkívül a ligandumok részt vesznek a reverzibilis kötődésben, az inhibitorok pedig nem kovalensen kötődnek (különböző típusú gátlás történik attól függően, hogy ezek az inhibitorok kötődnek-e az enzimhez, az enzim-szubsztrát komplexhez vagy mindkettőhöz). A multivalencia, amely bizonyos, a kapcsolódó tudományos kutatásokban részt vevő embereket különös érdeklődéssel bír, egy olyan jelenség, amelyet az egyik egységen elhelyezett több ligandum egyidejű kötődése jellemez egy másik egység több egybeeső receptorához. [8] Mindenesetre a ligandumnak a partneréhez való kötődése nyilvánvaló, mivel számos fehérje funkcionalitását gyakorolhatja. [2] A ligandum-aktivált receptor tirozin-kinázok, ahogyan néha hivatkoznak rájuk, egyedülálló tulajdonságot mutatnak. Miután egy tirozin receptor kináz kötődik ligandumához, képes kötődni a sejt citoszoljában található tirozin kinázhoz. [2]

Eritrociták Szerk

Példa erre a működésben lévő triggerrendszerre az a folyamat, amellyel az eritrociták képződését szabályozzák. Az emlősök rendelkeznek ezzel a rendszerrel, amely a vesékben kezdődik, ahol a fejlődési jel keletkezik. [2] A fejlődési jel, amelyet citokinnek is neveznek, ebben az esetben az eritropoetin. (A citokinek a hematopoietikus sejtek proliferációjának és differenciálódásának kulcsfontosságú szabályozói.) Az eritropoietin aktivitása akkor indul be, amikor a hematopoietikus citokin receptorok aktiválódnak. [9] Az eritrocita szabályozásban az eritropoetin egy 165 aminosavat tartalmazó fehérje, amely a JAK citoplazmatikus protein kináz aktiválásában játszik szerepet. [2] Egyes újabb kutatások eredményei azt is jelezték, hogy a fent említett citokin receptorok a JAK tirozin kináz család tagjaival működnek együtt. A citokin receptorok aktiválják a JAK kinázokat. Ez a sejtmembránban található számos jelátviteli fehérje foszforilációját eredményezi. Ez ezt követően mind a ligandum által közvetített receptorok stimulálására, mind az intracelluláris jelátviteli útvonal aktiválására hatással van. [9] A JAK kinázok szubsztrátjai bizonyos génválaszokat és egyebeket közvetítenek. [9] A folyamat a vérsejtek termelésének közvetítéséért is felelős. [2] Ebben az esetben az eritropoetin a megfelelő plazmamembrán receptorhoz kötődik, dimerizálva a receptort. [2] A dimer felelős a JAK kináz aktiválásáért a kötődésen keresztül. [2] Az eritropoetinreceptor citoplazmatikus doménjében található tirozinmaradékokat ennek következtében az aktivált JAK protein-kináz foszforilezi. [2] Összességében az is, hogy a receptor tirozin-kinázt így aktiválhatja egy ligand, hogy szabályozza az eritrocita képződést.

Egyéb példák Szerkesztés

A faktor által befolyásolt protein tirozin kináz aktivitás további, ehhez hasonló esetei is léteznek. Egy adapterfehérje, mint például a Grb2, a receptor protein-kinázok hatására foszfát-tirozin-maradékokhoz kötődik. Ez a mechanizmus egy közönséges, amely fehérje-fehérje kölcsönhatásokat vált ki. [2]

Ezen túlmenően, egy további körülmény illusztrálására, meghatározták, hogy az inzulinhoz kapcsolódó tényezők befolyásolják a tirozin-kinázt. Az inzulinreceptor-szubsztrátok olyan molekulák, amelyek az inzulin hatásának szabályozásával a jelátvitelben működnek. [2] Sok receptorenzimnek szorosan összefügg a szerkezete és a receptor tirozin kináz aktivitása, és megállapították, hogy az alap- vagy prototípus receptorenzim az inzulin. [2] Az IRS2 és IRS3 inzulinreceptor-szubsztrátok egyedi jellemző szöveti funkcióval és eloszlással rendelkeznek, ami arra szolgál, hogy fokozza a jelátviteli képességeket a receptor tirozin-kinázok által elindított útvonalakban. [2] Aktivált IRS-1 molekulák fokozza az inzulin által keltett jel. [2] Ezzel szemben az inzulinreceptor rendszer úgy tűnik csökkenteni az endoszomális jelátvitel hatékonysága. [7]

Az epidermális növekedési faktor receptorrendszert, mint olyant, köztes példaként használták. [7] Ebben az esetben bizonyos jelek a tényleges sejtfelszínről jönnek létre, de úgy tűnik, hogy más jelek az endoszómák belsejéből származnak. Ez a sokféle funkció eszköz lehet ligandum-specifikus jelek létrehozására. [7] Ez alátámasztja azt az elképzelést, hogy a trafik, a fehérjék mRNS-transzlációt követő módosításának kifejezése létfontosságú lehet a receptor jelátviteli funkciója szempontjából.


Lehet-e erősen szabályozni egy konstitutívan aktív kinázt? - Biológia

Az epidermális növekedési faktor receptor (EGF) III. típusú változata (EGFRvIII) az EGF receptor konstitutívan aktív, természetesen előforduló mutációja, amely számos humán daganatban megtalálható. Amikor NIH3T3 fibroblasztokban túlzottan expresszálódik, az EGFRvIII transzformációt indukál a sejtnövekedés fokozásával és az apoptózis csökkentésével. A downstream jelátviteli utak elemzése feltárta, hogy az extracelluláris szignál által szabályozott kináz aktivitás lefelé szabályozott, ami kétségeket támaszt ezen útvonal transzformáció elősegítésében betöltött jelentőségét illetően. Megvizsgáltuk, hogy a c-Jun N-terminális kináz (JNK) útvonalat befolyásolta-e az EGFRvIII. Az EGFRvIII-t expresszáló NIH3T3 sejtek magas alapszintű JNK aktivitást mutattak, ami nem volt jelen a normál EGF receptort túlzottan expresszáló sejtekben. Az EGFRvIII-at túlzottan expresszáló sejtek EGF-receptor inhibitorokkal vagy foszfatidil-inozitol-3-kinázzal való kezelése a JNK aktivitás lelassulását eredményezte. Ezenkívül a JNK aktivitás leszabályozása a transzformációval kapcsolatos tulajdonságok elvesztésével járt, és nem volt bizonyíték a JNK aktivitására az apoptózis elősegítésében ezekben a sejtekben. Ezek az eredmények a JNK útvonal konstitutív aktiválását feltételezik az EGFRvIII transzformációjában.


Egy mitogén által aktivált protein kináz/extracelluláris szignál-szabályozott kináz kináz (MEK) függő transzkripciós program szabályozza a korai növekedési válasz 1 (EGR1) gén aktiválását az aminosav korlátozás alatt

Az emlőssejtekben az aminosav (AA) korlátozása jelátviteli kaszkádok gyűjteményét váltja ki, amelyeket együttesen AA válasznak (AAR) neveznek. Humán HepG2 hepatocelluláris karcinómában a korai növekedési válasz 1 (EGR1) gént AA depriváció vagy endoplazmatikus retikulum stressz indukálta. Felfedezték, hogy az AAR-függő EGR1 aktiváció független a jól jellemezhető GCN2-ATF4 útvonaltól, hanem a MEK-ERK jelátviteltől, az egyik MAPK útvonaltól függ. A ChIP azt mutatta, hogy az EGR1 proximális promoter régiójában konstitutívan kötött ELK1 foszforilálódott az AAR aktiválása után. A megnövekedett p-ELK1 kötődés az RNS polimeráz II fokozott de novo toborzásával járt az EGR1 promoterhez. Az EGR1 transzkripció nem indukálódott az endogén MEK-aktivitást nélkülöző HEK293T sejtekben, de az exogén konstitutívan aktív MEK túlzott expressziója a HEK293T sejtekben megnövekedett bazális és AAR-indukált EGR1 expressziót eredményezett. A humán vaszkuláris endoteliális növekedési faktor A (VEGF-A) gén, egy ismert EGR1-re reagáló gén ChIP elemzése mérsékelt növekedést mutatott ki az AAR-indukált EGR1 kötődésben a proximális promoterben, és erősen indukálható kötődést az első intronban lévő helyre. Ezek az adatok együttesen egy új, AA-aktivált MEK-ERK-ELK1 jelzőmechanizmust dokumentálnak.

Kulcsszavak: ATF4 aminosav aminosav válasz Aszparagin szintetáz géntranszkripció HepG2 sejtek Hepatocelluláris karcinóma Mitogén által aktivált protein kináz (MAPK) transzkripció.

© 2014: The American Society for Biochemistry and Molecular Biology, Inc.


Lehet-e erősen szabályozni egy konstitutívan aktív kinázt? - Biológia

A szérum és a glükokortikoid által szabályozott kinázok (SGK) szerin/treonin protein kinázok családját alkotják, amelyek szerkezeti és szekvenciai hasonlóságot mutatnak a protein kináz B (PKB)/Akt családdal. A fő különbség e két család között az, hogy az SGK-kban nincs lipidkötő, pleckstrin homológ domén. A pleckstrin homológ domén hiánya ellenére a három humán izoforma aktiválása a PKB-hoz hasonlóan a növekedési faktorok és mitogének által indukált foszfatidil-inozitol 3'-kináz (PI3K) útvonaltól függ. A teljes hosszúságú SGK3 egy teljes Phox homológia (PX) domént tartalmaz, amely a fehérjét az endoszómák felé célozza. Mind a funkcionális PX domén, mind a PI3K aktiválása szükséges az SGK3 két szabályozó helyen (Thr-320 és Ser-486) ​​történő foszforilációjához, és ezt követően a kinázaktivitás indukálásához. A PDK1 foszforilezi az endoszómához kapcsolódó SGK3-at a Thr-320-nál, míg az SGK3 plazmamembránba való eltérítése, ahol a PDK1 normális esetben aktiválja a PKB-t, megzavarja az SGK3 PDK1 foszforilációját. Egy kiméra fehérje, amelyben az SGK3 karboxil-terminális hidrofób motívuma (HM) kicserélődött a PRK2 HM-ére, konstitutívan aktív. Végül bemutatjuk, hogy az SGK3 aktiválása PX domén-függetlenné válik, ha a HM foszforilálódik. Összességében ezek az adatok azt mutatják, hogy az SGK3 endoszómákba történő célba juttatása, PX doménje által közvetítve, elengedhetetlen az SGK3 megfelelő aktiválásához, valószínűleg az SGK3 endoszomális, PI3K-függő és sztaurosporin-érzékeny HM-kinázzal való együttes lokalizációja miatt.


Anyagok és metódusok

A bombesin receptor család filogenetikai és szelekciós elemzése

A bombezin receptor család tagjainak exonjait, valamint két paralóg gént (CCHaR-1 és CCHaR-2) és egy csoporton kívüli gént (EDNRA) transzláltak az aminosavszekvenciába, és az alapértelmezett beállításokkal a ClustalX 1.8-as verziójához igazították [70]. A megfelelő fajokat és géneket az S1 táblázat tartalmazza. Az aminosavszekvenciák többszörös egymásba igazításán alapuló gyökértelen fatopológiát a Maximum Likelihood módszerrel kaptuk meg a MEGA 6.06-ban [71]. A PAML 4.4-es verziójának elágazási hely modelljét használtuk az érdeklődők pozitív szelekcióinak tesztelésére. A filogenetikai elemzéshez a fajok a következők voltak: Homo: H. sapiens Pán: P. trogloditák Mus: M. musculus Rattus: R. norvegicus Sus: S. scrofa Capra: C. hircus Ovis: O. Kos Canis: C. lupus familiaris Felis: F. catus Orycteropus: O. afer Loxodonta: L. afrikána Phascolarctos: P. cinereus Monodelphis: M. domestica Csőrös emlős: O. anatinus Gallus: G. gallus Anolis: A. carolinensis Chrysemys: C. picta Xenopus: x. tropicalis Lepisosteus: L. oculus Danio: D. rerio Saccoglossus: S. kowalevskii Acanthaster: A. planci Strongylocentrotus: S. purpuratus Apis: A. mellifera Nasonia: N. vitripennis Drosophila: D. melanogaster Aedes: A. aegypti Tribolium: T. kasztán Camponotus: C. floridanus Parasteatoda: P. tepidariorum Myzus: M. persicae Lingula: L. anatina Crassostrea: C. virginica és Mizuhopecten: M. yessoensis.

Genetikai és szerkezeti elemzés

A WebLogo-t arra fejlesztették ki, hogy szekvencialogókat állítson elő, amelyek a minták grafikus ábrázolásai egy többszörös szekvencia-illesztésen belül, és hogy segítse e minták felfedezését és elemzését [72, 73]. Megvalósítottuk a WebLogo-t, hogy megtaláljuk a megőrzött helyeket/területeket a GPCR-ekben. A GPCR-ek szekvencia hasonlóságát és azonosságát a Sequence Manipulation Suite segítségével számítottuk ki. Az I-TASSER algoritmust fehérje konformáció előrejelzésére fejlesztették ki [74, 75]. A GPCR-ek szerkezetét az I-TASSER segítségével jósoltuk meg. A GPCR-ek struktúrái közötti RMSD-t a Rosetta szoftverrel számítottuk ki. A Discovery Studio egy csomagcsomag a receptorok lehetséges kötőzsebeinek előrejelzésére. A RosettaDock egy Monte Carlo-alapú többléptékű dokkolási algoritmus, amely optimalizálja mind a merev test orientációját, mind az oldallánc konformációját [41]. A megjósolt lehetséges legnagyobb kötőzsebnek megfelelően a fehérjekomplex kezdeti konformációja létrejött a RosettaDockban való hasznosításhoz. A Rosetta FelxPepDock modulja rugalmas peptidek és globuláris fehérjék közötti komplexek nagy felbontású modelljeinek létrehozására szolgál [76]. Ezért a legalacsonyabb energiájú peptid-fehérje komplexet a Rosetta FelxPepDock moduljával optimalizáltuk. A kötőhelyeket a peptid-fehérje komplexek első 10 alacsony energia-pontszámmal optimalizált modellje alapján elemeztük. A PyMOL egy molekuláris grafikai rendszer GPCR-ek háromdimenziós (3D) struktúráinak megjelenítésére [77].

Peptidek és BRS3 mutánsok előállítása

Ami a ligandum peptideket illeti, két konzervált és konszenzus peptid (GRP-GSHWAVGHLM-NH)2 és NMB-GNLWATGHFM-NH2) és az mBRS3 N-terminális peptidjei (MSQRQSQSPNQTLISITNDTETSSSVVSNDTTHKGWTGDNS-NH2) a Biotech Bioengineering (Sanghaj, Kína) cégtől szintetizáltak receptor-ligandum-funkciós vizsgálatokhoz, kivéve a radioligandumkötési vizsgálatokat. A BRS3 mutánsokat pontmutációk bevitelével állítottuk elő QuikChange II helyspecifikus mutagenezis készlettel (Agilent Technologies). Röviden, a kívánt pontmutációkkal átfedő primereket használtuk a vad típusú BRS3 amplifikálására. A szülői plazmidot DpnI enzimmel emésztettük, és az újonnan szintetizált plazmidot templátként használtuk a BRS3 mutánsok PCR-amplifikálásához, mielőtt a pcDNA3.1-V5-His plazmidba szubklónoztuk volna.

Luciferáz vizsgálatok

A BRS3 konstitutív aktivitásának kimutatására HEK293 sejteket oltottunk 24 lyukú lemezekre, és kotranszfektáltuk a CRE/NFAT-RE/SRF-RE/SRE luciferáz riporter plazmidokkal (50 ng), a különböző fajokból származó BRS3-mal vagy a különböző BRS3 mutánsokkal. dózisban (10 ng/50 ng/150 ng) 24 óra elteltével a sejteket további 12 órán át szérummentes tápközegben inkubáltuk a luciferáz vizsgálat előtt. As for peptide supplementation treatment, HEK293 cells were cotransfected with the CRE/NFAT-RE/SRF-RE/SRE luciferase reporter plasmids (50 ng) and various genes (300 ng) of the bombesin receptor family. After 24 h, cells were further incubated in serum-free media and GRP/NMB peptides (0/10/100/1,000 nM) or the N-terminal peptides of mBRS3 (1,000 nM) with different concentrations for another 12 h. Luciferase activities were determined using luciferase assay kits (Beyotime, Shanghai, China) and normalized to β-galactosidase activity. All experiments were performed at least three times in triplicates. HEK293 cells transfected with pcDNA were used as a blank control in all luciferase experiments, and the fold was calculated compared to blank control.

ERK1/2 phosphorylation

For ERK1/2 phosphorylation, HEK293 cells were seeded in 24-well plates and transfected with GRPR, NMBR, BRS3, mutants of different species’ BRS3, or an empty vector plasmid, pcDNA3.1-V5-His plasmid (300 ng). After 36 h, cells were incubated in serum-free media for another 8 h stimulated with 1,000 nm GRP or NMB for 0, 2, and 5 min or 0, 2, 5, and 10 min homogenized in lysis buffer containing 50 mM Tris-HCl (pH 6.8) and 2% sodium dodecyl sulphate (SDS) with freshly added protease/phosphatase inhibitor cocktail (Cell Signaling Technology, Indianapolis, IN, USA) and subjected to western blot using specific antibodies for ERK1/2 (Cell Signaling Technology, Cat. #9102, 1:2,000) and phosphor-ERK1/2 (Cell Signaling Technology, Cat. #9101, 1:1,000). Each sample with an equal amount of protein was mixed with 6×SDS sample buffer, boiled for 5 min, and separated on 10% SDS-polyacrylamide gel electrophoresis (PAGE) before transferring the proteins onto a PVDF membrane. The membranes were then blocked at room temperature for 1 h with 5% milk powder in Tris-buffered saline-Tween (TBST), followed by subsequent incubation at 4°C overnight in TBST containing the different primary antibodies (1:1,000 dilution). After washing three times (10 min each time) with TBST, the membranes were incubated for 1 h in TBST containing the secondary antibodies (1:2,000 dilution), followed by washing three times (10 min each time) with TBST, prior to detection by chemiluminescence.

Expression pattern of BRS3 receptors and their mutants

HEK293 cells were seeded in 24-well plates, and the expression vector pcDNA3.1-V5-His containing the different BRS3 orthologs or relevant mutants was transiently transfected into HEK 293 cells using Lipofectamine 2000 (Invitrogen) with 300 ng of different species’ BRS3 receptor or mutants. After 48 h, supernatant was removed and cells rinsed twice with PBS, homogenized in lysis buffer, and subjected to western blot analysis using specific Bombesin Receptor Polyclonal Antibody (Thermo Fisher, Cat. #PA5-26484/Lot. #A81B02N, 1:1,000) and actin as a control (Sigma-Aldrich, A5441, 1:5,000).

Intracellular calcium assay

Intracellular calcium was measured using the non-wash calcium assay Fluo8 kit (ab112129, Abcam) according to the manufacturer’s instructions. Briefly, HEK293 cells were seeded in 24-well plates and were transfected with GRPR, NMBR, BRS3, or the empty vector plasmid pcDNA3.1-V5-His (300 ng) and incubated overnight at 37°C with 5% CO2. The next day, the cells were replated into a 96-well assay plate (black plate and clear bottom). After 12 h, growth media were aspirated, and calcium dye was added. Following incubation for 30 min at 37°C and 10 min at room temperature, GRP (10 nM) or NMB (10 nM) was added, and assay plates were placed into a fluorescence kinetic plate reader (Hamamatsu) immediately. The basal fluorescence intensity was recorded 15 times at 1 Hz for 20 s. The results were normalized to the average basal fluorescence intensity in ratio, and the peak response was used for the result calculation. Calcium fold was calculated using no stimulation data as standard value.

Radioligand binding assays

The unlabeled ligand peptides GRP (APLQPGGSPALTKIYPRGSHWAVGHLM) and NMB (YKIKVNPRGNLWATGHFM) were synthesized by [ 125 I]-Tyr 42 -GRP and [ 125 I]-Tyr-NMB (Anhui Guoping Pharmaceutical) at a specific activity of 870 Ci/mmol and 690 Ci/mmol, respectively, and were prepared by the Beijing North Institute of Biotechnology. HEK293 cells were seeded in a 10-cm tissue culture dish at a density of 10 6 cells per dish and grown overnight at 37°C in growth medium. The following morning, 5 μg of different species’ BRS3 plasmids were transfected. After 6 h, the medium was replaced with growth medium. Cells were maintained at 37°C in a 5% CO2 atmosphere and used 48 h later for binding assays. The positive control group included transfected GRPR and NMBR the test group consisted of transfected BRS3 from different species. Then, [ 125 I]-Tyr 42 -GRP and [ 125 I]-Tyr-NMB were used as the ligands to assess affinity to the various receptors. Briefly, 48 h after transient transfection with Lipofectamine, disaggregated transfected cells were incubated for 1 h at 21°C in 250 μl of binding buffer containing 24.5 mM HEPES (pH 7.4), 98 mM NaCl, 6 mM KCl, 2.5 mM KH2PO4, 5 mM sodium pyruvate, 5 mM sodium fumarate, 5 mM sodium glutamate, 2 mM glutamine, 11.5 mM glucose, 0.5 mM CaCl2, 1 mM MgCl2, 0.01% (w/v) soybean trypsin inhibitor, 0.2% (v/v) amino acid mixture, 0.2% (w/v) BSA, and 0.05% (w/v) bacitracin with 50 pM of [ 125 I]-Tyr 42 -GRP (870 Ci/mmol) or 50 pM of [ 125 I]-Tyr-NMB (690 Ci/mmol) in the presence of the indicated concentration of unlabeled peptides. The cell concentration was adjusted to between 0.05 and 4 × 10 6 cells/ml for each receptor such that less than 20% of the total added radioactive ligand was bound during the incubation, and the results were compared to cells transfected with GRPR or NMBR adjusted in concentration to bind a similar amount of ligand. After the incubation, 100 μl aliquots were added to 1.5-ml microfuge tubes, which contained 100 μl of binding buffer to determine the total radioactivity. The bound tracer was separated from unbound tracer by pelleting the cells through the binding buffer by centrifugation at 10,000g in a Microfuge E (Beckman) for 3 min. The supernatant was aspirated, and the pelleted cells were rinsed twice with a washing buffer that contained 1% (w/v) BSA in PBS. The amount of radioactivity bound to the cells was measured in a Cobra II Gamma counter (Packard Instruments). Binding was expressed as the percentage of total radioactivity that was associated with the cell pellet. All binding values represented saturable binding nonsaturable binding was <15% of the total binding in all experiments. Each point was measured in duplicate, and each experiment was replicated at least four times. Calculation of affinity was performed by determining the IC50 (the GRP or NMB concentration causing half-maximum inhibition of binding), using the curve-fitting program KaleidaGraph (Synergy Software), and the Hill coefficient (nH) was calculated from the displacement curve by using GraphPad Prism [78]. All the experiment data were calculated using 1 pM ligand-treated as 100% control.

The prediction of binding pocket of Gs, G12, and GPCR

Discovery Studio is a suite of packages for simulating macromolecule systems [37]. The largest possible binding pocket of Gs, G12, and GPCR was then predicted by Discovery Studio 3.0 [37]. These predicted pockets were utilized to construct an initial coarse model of the G protein–GPCR complex. The molecular model of GPCR receptors and G protein were predicted by the I-TASSER algorithm. I-TASSER was designed for protein structure modeling by iterative threading assembly simulations [27]. Starting from an amino acid sequence, I-TASSER first generates 3D atomic models from multiple threading alignments and iterative structural assembly simulations. The function of the protein is then inferred by structurally matching the 3D models with other known proteins. The output from a typical server run contains full-length secondary and tertiary structure predictions and functional annotations on ligand-binding sites, Enzyme Commission numbers, and Gene Ontology terms. An estimate of accuracy of the predictions is provided based on the confidence score of the modeling. Previous study revealed the existence of a selectivity barcode (that is, patterns of amino acids) on each of the 16 human G proteins, which is recognized by distinct regions on the approximately 800 human receptors [1]. Therefore, the docking between GPCRs and G proteins was explored based on the known R-G protein co-crystal structures and homology modeling. The docking process between G protein and GPCRs was the same as the docking process between BRS3 receptors and GPR/NMB. The model with the lowest energy was then obtained using Rosetta software (RosettaDock and FelxPepDock module) [38]. All types of noncovalent interactions at the atomic level in a protein structure could be identified by the RING (http://protein.bio.unipd.it/ring/) [40]. Binding sites between proteins in complex were then obtained by RING.

CAMP assay

HEK293 cells were cultured as a monolayer on culture plates to 80%–90% confluency. Cells were harvested and centrifuged twice at 1,000 rpm for 5 min. The amount of cAMP produced was determined with the cAMP ELISA Detection Kit (GenScript). Three thousand cells per well were preincubated for 45 min at 37°C and subsequently at room temperature for 3 h with a range of agonist concentrations. The incubation was stopped by adding detection mix and antibody solution, according to the instructions of the manufacturer. The generated fluorescence intensity was then quantified finally with Synergy H1(BioTek).

GTPgamma35S incorporation assay

Assays were run in 20 mM HEPES, 100 mM NaCl, 8 mM MgCl2, and 10 μg·mL –1 at pH 7.4 in a final volume of 200 μl in 1.5-ml tubes at 25°C. One hundred microliters of membrane preparation (20 μg protein per well) containing 5 μM GDP was added, followed by the addition of 10 μl of buffer agonists being tested and 10 μl of GTPgamma35S to provide a final concentration in the assay of 400 pM. Cell membranes were incubated for 30 min at 25°C with agonists, followed by addition of GTPgamma35S and incubation for an additional 60 min. Preincubation was employed to ensure that agonists were at equilibrium during the labeling period. Then, 35S-labeled membranes were solubilized for 30 min with 0.27% Nonidet P-40, followed by the addition of the desired antibody (10 μl/well) to provide a final dilution of 1/200 and incubation for an additional 60 min. Fifty microliters of suspended anti-IgG-coated SPA beads was added per tube. Tubes were incubated for 3 h and then were centrifuged, and their radioactivity was determined using a Aloka LSC-8000 counter.

Statisztikai analízis

Experiments were repeated independently at least three times. Results were analyzed using GraphPad Prism 5. Differences between two groups were compared using two-tailed Student t teszt. One-way ANOVA was followed by a Fisher’s LSD post hoc test to evaluate the differences among multiple groups. Data are expressed as mean ± SEM. Calculations were done with a standard statistical package (SPSS for Windows, version 21). Statistical significance was defined as a P value < 0.05 (*) or P value < 0.01(**) [79].


Can a constitutively active kinase be highly regulated? - Biológia

The Rho GTPases are involved in many signaling pathways and cellular functions, including the organization of the actin cytoskeleton, regulation of transcription, cell motility, and cell division. The p21 (Cdc42/Rac)-activated kinase PAK mediates a number of biological effects downstream of these Rho GTPases (reviewed by [1]). The phosphorylation state of mammalian PAK is highly regulated: upon binding of GTPases, PAK is potently activated by autophosphorylation at multiple sites, although the mechanisms of PAK downregulation are not known. We now report two PP2C-like serine/threonine phosphatases (POPX1 and POPX2) that efficiently inactivate PAK. POPX1 was isolated as a binding partner for the PAK interacting guanine nucleotide exchange factor PIX [2]. The dephosphorylating activity of POPX correlates with an ability to block the in vivo effects of active PAK. Consonant with these effects on PAK, POPX can also inhibit actin stress fiber breakdown and morphological changes driven by active Cdc42 V12 . The association of the POPX phosphatases with PAK complexes may allow PAK to cycle rapidly between active and inactive states it represents a unique regulatory component of the signaling pathways of the PAK kinase family.


Lábjegyzetek

The costs of publication of this article were defrayed in part by the payment of page charges. This article must therefore be hereby marked hirdetés in accordance with 18 U.S.C. Section 1734 solely to indicate this fact.

↵ 1 Supported by Grants CA62168 (to D. R. W.), NS10828 (to A. A. and J. V. B.), DK39773 (to J. V. B.) from the NIH the United States Army Medical Research and Materiel Command DAMD17-96-1-6152 (to D. R. W.) the National Foundation for Cancer Research (to D. R. W.) The American Heart Association—Massachusetts Division and CONICIT grants S1-96001340 and G-9700613 (to M. R. and M. S. R.).

↵ 2 To whom requests for reprints should be addressed, D. R. W. at Jake Gittlen Cancer Research Institute, Room C7810, Box H-059, Pennsylvania State University College of Medicine, 500 University Drive, Hershey, PA 17033-2390 or A. A. at Renal Unit, Massachusetts General Hospital-East, 149 13th Street, Charlestown, MA 02129.

↵ 3 The abbreviations used are: MAP, mitogen-activated protein ERK, extracellular signal-regulated kinase MEK, MAP kinase/ERK kinase DS, MEK1-DS DD, MEK1-DD MMP, matrix metalloproteinase.


Nézd meg a videót: Koliko kilograma zaista treba da imaš za svoju visinu (Lehet 2022).